Loading...
Statistics
Chip Murray, Psychotherapist #84679
www.chipmurraymft.com/
I believe effective therapy starts with a safe and empathic connection between client and therapist. Whether you are considering therapy for the first time ...
Chipmurraymft.com
Chipmurraymft.com is hosted in
United States
/
San Francisco
.
Chipmurraymft.com uses HTTPS protocol.
Number of used technologies:
7.
First technologies:
CSS, Google Font API, Html,
Number of used javascripts: 1.
First javascripts:
W.js,
Number of used analytics tools:
1.
First analytics tools:
ComScore,
Its server type is:
nginx.
Its CMS is:
Wordpress.
Technologies in use by Chipmurraymft.com
Technology
Number of occurences: 7
- CSS
- Google Font API
- Html
- Html5
- Javascript
- Php
- Pingback
Advertisement
Javascripts
Number of occurences: 1
- w.js
Content Management System
Number of occurences: 1
- Wordpress
Analytics
Number of occurences: 1
- comScore
Server Type
- nginx
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Chipmurraymft.com
SSL certificate
- name: /CN=tls.automattic.com
- subject:
- CN: tls.automattic.com
- hash: 6338c477
- issuer:
- C: US
- O: Let's Encrypt
- CN: Let's Encrypt Authority X3
- version: 2
- serialNumber: 302046798112104309934761431028409386613512
- validFrom: 160408153700Z
- validTo: 160707153700Z
- validFrom_time_t: 1460129820
- validTo_time_t: 1467905820
- extensions:
- keyUsage: Digital Signature, Key Encipherment
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- basicConstraints: CA:FALSE
- subjectKeyIdentifier: 44:63:4F:22:F7:7D:3B:B6:FD:CD:4B:83:3F:86:04:9B:95:D0:3D:F9
- authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
- authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
- subjectAltName: DNS:chinesetranslation.live, DNS:chinesischinlandshut.de, DNS:chinetography.com, DNS:chinganadelcerro.cl, DNS:chinglish101.com, DNS:chingshinstudent.com, DNS:chinhle.net, DNS:chinjulie.com, DNS:chinjulie.org, DNS:chinooutreach.org, DNS:chinorbust.com, DNS:chinsblog.com, DNS:chinseisuke.com, DNS:chinsontour.com, DNS:chiomegaunc.com, DNS:chiopaniagua.com, DNS:chip-carter.com, DNS:chipaware.org, DNS:chiphomeprogram.com, DNS:chipmurraymft.com, DNS:chipoftheoldblog.com, DNS:chippewasecurity.com, DNS:chippewavalleyfinancialservice.com, DNS:chipsorsalad.com, DNS:chipthechefseries.com, DNS:tls.automattic.com, DNS:www.chinesetranslation.live, DNS:www.chinesischinlandshut.de, DNS:www.chinetography.com, DNS:www.chinganadelcerro.cl, DNS:www.chinglish101.com, DNS:www.chingshinstudent.com, DNS:www.chinhle.net, DNS:www.chinjulie.com, DNS:www.chinjulie.org, DNS:www.chinooutreach.org, DNS:www.chinorbust.com, DNS:www.chinsblog.com, DNS:www.chinseisuke.com, DNS:www.chinsontour.com, DNS:www.chiomegaunc.com, DNS:www.chiopaniagua.com, DNS:www.chip-carter.com, DNS:www.chipaware.org, DNS:www.chiphomeprogram.com, DNS:www.chipmurraymft.com, DNS:www.chipoftheoldblog.com, DNS:www.chippewasecurity.com, DNS:www.chippewavalleyfinancialservice.com, DNS:www.chipsorsalad.com, DNS:www.chipthechefseries.com
- certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/
Number of occurences: 12
- Name:
Content: https://www.facebook.com/WordPresscom - Name: viewport
Content: width=device-width, initial-scale=1 - Name: generator
Content: WordPress.com - Name: twitter:site
Content: @wordpressdotcom - Name: twitter:image
Content: https://chipmurraymftdotcom.files.wordpress.com/2015/09/chip_profile_shot1.png?w=240 - Name: twitter:card
Content: summary - Name: twitter:description
Content: Visit the post for more. - Name: application-name
Content: Chip Murray, Psychotherapist #84679 - Name: msapplication-window
Content: width=device-width;height=device-height - Name: msapplication-task
Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico - Name: title
Content: About | Chip Murray, Psychotherapist #84679 on WordPress.com - Name: description
Content: I believe effective therapy starts with a safe and empathic connection between client and therapist. Whether you are considering therapy for the first time to address an issue or problem, or resuming after taking a break, my job is to make this process meaningful, helpful, and educational from the very beginning. Although the thought of…
Server / Hosting
- IP: 192.0.78.25
- Latitude: 37.75
- Longitude: -122.42
- Country: United States
- City: San Francisco
Rname
- ns2.wordpress.com
- ns1.wordpress.com
- ns3.wordpress.com
Target
- hostmaster.wordpress.com
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Sat, 16 Apr 2016 04:20:35 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://chipmurraymft.com/
X-ac: 3.ams _dca
HTTP/1.1 200 OK
Server: nginx
Date: Sat, 16 Apr 2016 04:20:36 GMT
Content-Type: text/html; charset=UTF-8
Connection: keep-alive
Vary: Accept-Encoding
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
Link: ; rel=shortlink
X-ac: 3.ams _dca
DNS
host: chipmurraymft.com
- class: IN
- ttl: 299
- type: A
- ip: 192.0.78.24
host: chipmurraymft.com
- class: IN
- ttl: 299
- type: A
- ip: 192.0.78.25
host: chipmurraymft.com
- class: IN
- ttl: 86400
- type: NS
- target: ns2.wordpress.com
host: chipmurraymft.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1.wordpress.com
host: chipmurraymft.com
- class: IN
- ttl: 86400
- type: NS
- target: ns3.wordpress.com
host: chipmurraymft.com
- class: IN
- ttl: 86400
- type: SOA
- mname: ns1.wordpress.com
- rname: hostmaster.wordpress.com
- serial: 2005071858
- refresh: 14400
- retry: 7200
- expire: 604800
- minimum-ttl: 300
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.hipmurraymft.com, www.cdhipmurraymft.com, www.dhipmurraymft.com, www.crhipmurraymft.com, www.rhipmurraymft.com, www.cthipmurraymft.com, www.thipmurraymft.com, www.cvhipmurraymft.com, www.vhipmurraymft.com, www.cfhipmurraymft.com, www.fhipmurraymft.com, www.cghipmurraymft.com, www.ghipmurraymft.com, www.chhipmurraymft.com, www.hhipmurraymft.com, www.cnhipmurraymft.com, www.nhipmurraymft.com, www.cmhipmurraymft.com, www.mhipmurraymft.com, www.cjhipmurraymft.com, www.jhipmurraymft.com, www.cipmurraymft.com, www.cheipmurraymft.com, www.ceipmurraymft.com, www.chdipmurraymft.com, www.cdipmurraymft.com, www.chcipmurraymft.com, www.ccipmurraymft.com, www.chuipmurraymft.com, www.cuipmurraymft.com, www.chjipmurraymft.com, www.cjipmurraymft.com, www.chipmurraymft.com, www.cipmurraymft.com, www.chbipmurraymft.com, www.cbipmurraymft.com, www.chgipmurraymft.com, www.cgipmurraymft.com, www.chpmurraymft.com, www.chirpmurraymft.com, www.chrpmurraymft.com, www.chifpmurraymft.com, www.chfpmurraymft.com, www.chivpmurraymft.com, www.chvpmurraymft.com, www.chikpmurraymft.com, www.chkpmurraymft.com, www.chi,pmurraymft.com, www.ch,pmurraymft.com, www.chibpmurraymft.com, www.chbpmurraymft.com, www.chigpmurraymft.com, www.chgpmurraymft.com, www.chitpmurraymft.com, www.chtpmurraymft.com, www.chiypmurraymft.com, www.chypmurraymft.com, www.chiupmurraymft.com, www.chupmurraymft.com, www.chijpmurraymft.com, www.chjpmurraymft.com, www.chimpmurraymft.com, www.chmpmurraymft.com, www.chinpmurraymft.com, www.chnpmurraymft.com, www.chimurraymft.com, www.chipimurraymft.com, www.chiimurraymft.com, www.chipkmurraymft.com, www.chikmurraymft.com, www.chipumurraymft.com, www.chiumurraymft.com, www.chipjmurraymft.com, www.chijmurraymft.com, www.chiplmurraymft.com, www.chilmurraymft.com, www.chipurraymft.com, www.chipmpurraymft.com, www.chippurraymft.com, www.chipmourraymft.com, www.chipourraymft.com, www.chipmiurraymft.com, www.chipiurraymft.com, www.chipmkurraymft.com, www.chipkurraymft.com, www.chipm.urraymft.com, www.chip.urraymft.com, www.chipmuurraymft.com, www.chipuurraymft.com, www.chipmjurraymft.com, www.chipjurraymft.com, www.chipmnurraymft.com, www.chipnurraymft.com, www.chipm-urraymft.com, www.chip-urraymft.com, www.chipmrraymft.com, www.chipmuwrraymft.com, www.chipmwrraymft.com, www.chipmuerraymft.com, www.chipmerraymft.com, www.chipmusrraymft.com, www.chipmsrraymft.com, www.chipmuarraymft.com, www.chipmarraymft.com, www.chipmuraymft.com, www.chipmuriraymft.com, www.chipmuiraymft.com, www.chipmuroraymft.com, www.chipmuoraymft.com, www.chipmurlraymft.com, www.chipmulraymft.com, www.chipmurlraymft.com, www.chipmulraymft.com, www.chipmur.raymft.com, www.chipmu.raymft.com, www.chipmuraymft.com, www.chipmurriaymft.com, www.chipmuriaymft.com, www.chipmurroaymft.com, www.chipmuroaymft.com, www.chipmurrlaymft.com, www.chipmurlaymft.com, www.chipmurrlaymft.com, www.chipmurlaymft.com, www.chipmurr.aymft.com, www.chipmur.aymft.com, www.chipmurrymft.com, www.chipmurraoymft.com, www.chipmurroymft.com, www.chipmurrapymft.com, www.chipmurrpymft.com, www.chipmurra9ymft.com, www.chipmurr9ymft.com, www.chipmurraymft.com, www.chipmurrymft.com, www.chipmurraiymft.com, www.chipmurriymft.com, www.chipmurrauymft.com, www.chipmurruymft.com, www.chipmurramft.com, www.chipmurrayzmft.com, www.chipmurrazmft.com, www.chipmurrayamft.com, www.chipmurraamft.com, www.chipmurraysmft.com, www.chipmurrasmft.com, www.chipmurraydmft.com, www.chipmurradmft.com, www.chipmurraymft.com, www.chipmurramft.com, www.chipmurraycmft.com, www.chipmurracmft.com, www.chipmurray mft.com, www.chipmurra mft.com, www.chipmurrayft.com, www.chipmurraympft.com, www.chipmurraypft.com, www.chipmurraymoft.com, www.chipmurrayoft.com, www.chipmurraymift.com, www.chipmurrayift.com, www.chipmurraymkft.com, www.chipmurraykft.com, www.chipmurraym.ft.com, www.chipmurray.ft.com, www.chipmurraymuft.com, www.chipmurrayuft.com, www.chipmurraymjft.com, www.chipmurrayjft.com, www.chipmurraymnft.com, www.chipmurraynft.com, www.chipmurraym-ft.com, www.chipmurray-ft.com,
Other websites we recently analyzed
- Bahnhof-Apotheke Bad Münstereifel
Nürnberg (Germany) - 78.46.1.60
Server software: Apache
Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery Fancybox, Php, Facebook Like button
Number of Javascript: 3
Number of meta tags: 1 - rainbowsprings.net
Switzerland - 141.8.225.124
Server software: Apache
Technology: Html - Zito y Priola
Rosario (Argentina) - 200.58.111.10
Server software: Apache
Technology: Html
Number of meta tags: 1 - å‚艇.network
Osaka (Japan) - 183.90.250.11
Server software: Apache
Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
Number of Javascript: 5
Number of meta tags: 3 - Lacné letenky - Seagle Air
Seagle Air ponúka lacné letenky do celého sveta. ZÃskajte výhodne lowcost letenky, last minute letenky a ÄalÅ¡ie lacné letenky za bezkonkurenÄnú cenu.Slovakia - 93.184.66.153
Server software: Apache
Technology: CSS, Html, Javascript
Number of Javascript: 1
Number of meta tags: 3 - AWAY REALTY | Лучшее агентÑтво зарубежной недвижимоÑти
HOMES.RU - AWAY REALTY: ÐÐ»Ð¸Ñ‚Ð½Ð°Ñ Ð·Ð°Ñ€ÑƒÐ±ÐµÐ¶Ð½Ð°Ñ Ð½ÐµÐ´Ð²Ð¸Ð¶Ð¸Ð¼Ð¾ÑÑ‚ÑŒ, ÑÐ»Ð¸Ñ‚Ð½Ð°Ñ Ð½ÐµÐ´Ð²Ð¸Ð¶Ð¸Ð¼Ð¾ÑÑ‚ÑŒ за рубежом, продажа домов за рубежом, квартира, апартаменты, вилла, пентхауÑ, коттедж, таунхауÑ, оÑобнÑк, дача, бунгало, офиÑ, землÑ, земельный учаÑток, Ñтраны мира, Европа, оÑтрова, Ñкзотика, Ð¿Ñ€Ð°Ð²Ð¾Ð²Ð°Ñ Ð¸Ð½Ñ„Ð¾Ñ€Ð¼Ð°Ñ†Ð¸Ñ, визы, опиÑание Ñтраны по недвижимоÑти, ÐвÑтриÑ, ВеликобританиÑ, ГерманиÑ, ИÑпаниÑ, ИталиÑ, ПортугалиÑ, ФранциÑ, ХорватиÑ, ЧерногориÑ.Netherlands - 109.206.190.54
Server software: nginx/1.8.0
Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Yandex.Metrika
Number of Javascript: 4
Number of meta tags: 5 - ALPHAHEADS - Creative and Collectable Toys for Children
Scottsdale (United States) - 198.71.155.170
Server software: Microsoft-IIS/7.0
Technology: Html
Number of meta tags: 1 - Willkommen bei MM PIZZA!
Austria - 84.116.32.65
Server software: Apache
Technology: CSS, Html, Php
Number of meta tags: 1 - Home
Palo Alto (United States) - 204.93.177.137
Server software: LiteSpeed
Technology: CSS, Html, Javascript, Swf Object
Number of Javascript: 2
Number of meta tags: 1 - Laurie Bodine START
Equip your kids with the mindset and skills they need to thrive in a highly competitive world.Houston (United States) - 108.167.135.120
Server software: Microsoft-IIS/7.5
Technology: CSS, Google Font API, Html, Html5, Javascript
Number of Javascript: 5
Number of meta tags: 3