Loading...
Statistics
Advertisement

Chip Murray, Psychotherapist #84679
www.chipmurraymft.com/
I believe effective therapy starts with a safe and empathic connection between client and therapist. Whether you are considering therapy for the first time ...

Chipmurraymft.com

Advertisement
Chipmurraymft.com is hosted in United States / San Francisco . Chipmurraymft.com uses HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Google Font API, Html, Number of used javascripts: 1. First javascripts: W.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Chipmurraymft.com

Technology

Number of occurences: 7
  • CSS
  • Google Font API
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 1
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Server Type

  • nginx

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Chipmurraymft.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 302046798112104309934761431028409386613512
    • validFrom: 160408153700Z
    • validTo: 160707153700Z
    • validFrom_time_t: 1460129820
    • validTo_time_t: 1467905820
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 44:63:4F:22:F7:7D:3B:B6:FD:CD:4B:83:3F:86:04:9B:95:D0:3D:F9
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:chinesetranslation.live, DNS:chinesischinlandshut.de, DNS:chinetography.com, DNS:chinganadelcerro.cl, DNS:chinglish101.com, DNS:chingshinstudent.com, DNS:chinhle.net, DNS:chinjulie.com, DNS:chinjulie.org, DNS:chinooutreach.org, DNS:chinorbust.com, DNS:chinsblog.com, DNS:chinseisuke.com, DNS:chinsontour.com, DNS:chiomegaunc.com, DNS:chiopaniagua.com, DNS:chip-carter.com, DNS:chipaware.org, DNS:chiphomeprogram.com, DNS:chipmurraymft.com, DNS:chipoftheoldblog.com, DNS:chippewasecurity.com, DNS:chippewavalleyfinancialservice.com, DNS:chipsorsalad.com, DNS:chipthechefseries.com, DNS:tls.automattic.com, DNS:www.chinesetranslation.live, DNS:www.chinesischinlandshut.de, DNS:www.chinetography.com, DNS:www.chinganadelcerro.cl, DNS:www.chinglish101.com, DNS:www.chingshinstudent.com, DNS:www.chinhle.net, DNS:www.chinjulie.com, DNS:www.chinjulie.org, DNS:www.chinooutreach.org, DNS:www.chinorbust.com, DNS:www.chinsblog.com, DNS:www.chinseisuke.com, DNS:www.chinsontour.com, DNS:www.chiomegaunc.com, DNS:www.chiopaniagua.com, DNS:www.chip-carter.com, DNS:www.chipaware.org, DNS:www.chiphomeprogram.com, DNS:www.chipmurraymft.com, DNS:www.chipoftheoldblog.com, DNS:www.chippewasecurity.com, DNS:www.chippewavalleyfinancialservice.com, DNS:www.chipsorsalad.com, DNS:www.chipthechefseries.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Chipmurraymft.com

Number of occurences: 12
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: twitter:image
    Content: https://chipmurraymftdotcom.files.wordpress.com/2015/09/chip_profile_shot1.png?w=240
  • Name: twitter:card
    Content: summary
  • Name: twitter:description
    Content: Visit the post for more.
  • Name: application-name
    Content: Chip Murray, Psychotherapist #84679
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: About | Chip Murray, Psychotherapist #84679 on WordPress.com
  • Name: description
    Content: I believe effective therapy starts with a safe and empathic connection between client and therapist. Whether you are considering therapy for the first time to address an issue or problem, or resuming after taking a break, my job is to make this process meaningful, helpful, and educational from the very beginning. Although the thought of…

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns2.wordpress.com
  • ns1.wordpress.com
  • ns3.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 16 Apr 2016 04:20:35 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Location: https://chipmurraymft.com/ X-ac: 3.ams _dca HTTP/1.1 200 OK Server: nginx Date: Sat, 16 Apr 2016 04:20:36 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.ams _dca

DNS

host: chipmurraymft.com
  1. class: IN
  2. ttl: 299
  3. type: A
  4. ip: 192.0.78.24
host: chipmurraymft.com
  1. class: IN
  2. ttl: 299
  3. type: A
  4. ip: 192.0.78.25
host: chipmurraymft.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: chipmurraymft.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: chipmurraymft.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: chipmurraymft.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hipmurraymft.com, www.cdhipmurraymft.com, www.dhipmurraymft.com, www.crhipmurraymft.com, www.rhipmurraymft.com, www.cthipmurraymft.com, www.thipmurraymft.com, www.cvhipmurraymft.com, www.vhipmurraymft.com, www.cfhipmurraymft.com, www.fhipmurraymft.com, www.cghipmurraymft.com, www.ghipmurraymft.com, www.chhipmurraymft.com, www.hhipmurraymft.com, www.cnhipmurraymft.com, www.nhipmurraymft.com, www.cmhipmurraymft.com, www.mhipmurraymft.com, www.cjhipmurraymft.com, www.jhipmurraymft.com, www.cipmurraymft.com, www.cheipmurraymft.com, www.ceipmurraymft.com, www.chdipmurraymft.com, www.cdipmurraymft.com, www.chcipmurraymft.com, www.ccipmurraymft.com, www.chuipmurraymft.com, www.cuipmurraymft.com, www.chjipmurraymft.com, www.cjipmurraymft.com, www.chipmurraymft.com, www.cipmurraymft.com, www.chbipmurraymft.com, www.cbipmurraymft.com, www.chgipmurraymft.com, www.cgipmurraymft.com, www.chpmurraymft.com, www.chirpmurraymft.com, www.chrpmurraymft.com, www.chifpmurraymft.com, www.chfpmurraymft.com, www.chivpmurraymft.com, www.chvpmurraymft.com, www.chikpmurraymft.com, www.chkpmurraymft.com, www.chi,pmurraymft.com, www.ch,pmurraymft.com, www.chibpmurraymft.com, www.chbpmurraymft.com, www.chigpmurraymft.com, www.chgpmurraymft.com, www.chitpmurraymft.com, www.chtpmurraymft.com, www.chiypmurraymft.com, www.chypmurraymft.com, www.chiupmurraymft.com, www.chupmurraymft.com, www.chijpmurraymft.com, www.chjpmurraymft.com, www.chimpmurraymft.com, www.chmpmurraymft.com, www.chinpmurraymft.com, www.chnpmurraymft.com, www.chimurraymft.com, www.chipimurraymft.com, www.chiimurraymft.com, www.chipkmurraymft.com, www.chikmurraymft.com, www.chipumurraymft.com, www.chiumurraymft.com, www.chipjmurraymft.com, www.chijmurraymft.com, www.chiplmurraymft.com, www.chilmurraymft.com, www.chipurraymft.com, www.chipmpurraymft.com, www.chippurraymft.com, www.chipmourraymft.com, www.chipourraymft.com, www.chipmiurraymft.com, www.chipiurraymft.com, www.chipmkurraymft.com, www.chipkurraymft.com, www.chipm.urraymft.com, www.chip.urraymft.com, www.chipmuurraymft.com, www.chipuurraymft.com, www.chipmjurraymft.com, www.chipjurraymft.com, www.chipmnurraymft.com, www.chipnurraymft.com, www.chipm-urraymft.com, www.chip-urraymft.com, www.chipmrraymft.com, www.chipmuwrraymft.com, www.chipmwrraymft.com, www.chipmuerraymft.com, www.chipmerraymft.com, www.chipmusrraymft.com, www.chipmsrraymft.com, www.chipmuarraymft.com, www.chipmarraymft.com, www.chipmuraymft.com, www.chipmuriraymft.com, www.chipmuiraymft.com, www.chipmuroraymft.com, www.chipmuoraymft.com, www.chipmurlraymft.com, www.chipmulraymft.com, www.chipmurlraymft.com, www.chipmulraymft.com, www.chipmur.raymft.com, www.chipmu.raymft.com, www.chipmuraymft.com, www.chipmurriaymft.com, www.chipmuriaymft.com, www.chipmurroaymft.com, www.chipmuroaymft.com, www.chipmurrlaymft.com, www.chipmurlaymft.com, www.chipmurrlaymft.com, www.chipmurlaymft.com, www.chipmurr.aymft.com, www.chipmur.aymft.com, www.chipmurrymft.com, www.chipmurraoymft.com, www.chipmurroymft.com, www.chipmurrapymft.com, www.chipmurrpymft.com, www.chipmurra9ymft.com, www.chipmurr9ymft.com, www.chipmurraymft.com, www.chipmurrymft.com, www.chipmurraiymft.com, www.chipmurriymft.com, www.chipmurrauymft.com, www.chipmurruymft.com, www.chipmurramft.com, www.chipmurrayzmft.com, www.chipmurrazmft.com, www.chipmurrayamft.com, www.chipmurraamft.com, www.chipmurraysmft.com, www.chipmurrasmft.com, www.chipmurraydmft.com, www.chipmurradmft.com, www.chipmurraymft.com, www.chipmurramft.com, www.chipmurraycmft.com, www.chipmurracmft.com, www.chipmurray mft.com, www.chipmurra mft.com, www.chipmurrayft.com, www.chipmurraympft.com, www.chipmurraypft.com, www.chipmurraymoft.com, www.chipmurrayoft.com, www.chipmurraymift.com, www.chipmurrayift.com, www.chipmurraymkft.com, www.chipmurraykft.com, www.chipmurraym.ft.com, www.chipmurray.ft.com, www.chipmurraymuft.com, www.chipmurrayuft.com, www.chipmurraymjft.com, www.chipmurrayjft.com, www.chipmurraymnft.com, www.chipmurraynft.com, www.chipmurraym-ft.com, www.chipmurray-ft.com,

Other websites we recently analyzed

  1. Welcome to POWERBILLLOAN.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  2. Neu Poetry
    Neu Poetry is Language expressed purposefully in an Artistic way & Seperate from normal communication, in order to amplify the importance of one's message.
    Jacksonville (United States) - 206.188.192.140
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery Validate, jQuery UI, Php, Web.com
    Number of Javascript: 43
    Number of meta tags: 3
  3. thegriffinsnest.com
    Burlington (United States) - 66.96.149.2
    Server software: Apache/2
    Technology: Html, Iframe
  4. angelersartist.com
    Scottsdale (United States) - 184.168.221.32
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe, Php
  5. ACCORSIFORAGGI.COM
    Höst (Germany) - 5.35.245.208
    Server software: nginx
    Technology: CSS, Html
    Number of meta tags: 1
  6. Tin tức - Sự kiện
    Website chính thức của Cảng Vụ Đường Thủy Nội Địa Khu Vực 3. Địa chỉ: 292/37/6 – 8 Bình Lợi, Q.Bình Thạnh, TP.HCM Điện thoại: (08) 3553 1982 - 1900 588 839
    Hanoi (Vietnam) - 124.158.12.75
    Server software: Apache/2.2.15 (CentOS)
    Technology: CSS, Html, Iframe, Javascript, jQuery, Php, Swf Object, Histats
    Number of Javascript: 13
    Number of meta tags: 3
  7. pamelaarmstrong.net
    Dover (United States) - 192.230.92.93
    Server software:
    Technology: Html, Iframe, Incapsula, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  8. Maroush Bakehouse, Serving delicious Lebanese Food London - Delicious Variety Of Lebanese Food In London Earl's Court
    Lebanese restaurant Earls Court, Near Cromwell Hospital London
    San Francisco (United States) - 199.34.228.59
    G Analytics ID: UA-73061776-1
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 10
    Number of meta tags: 5
  9. arevi travaux exterieurs enrobé béton 64 - présentation
    Rénovation de votre habitat intérieure, extérieure, cuisine, armoires, bains. Devis rapides et gratuits
    France - 188.165.33.133
    Server software: SiteW Webserver 1.2.0
    Technology: CSS, Google Font API, Html, SVG
    Number of Javascript: 1
    Number of meta tags: 6
  10. KenduriBisnis.Com Kumpulan Kolega Bisnis
    KENDURIBISNIS.COM Kumpulan Kolega Bisnis dan UMKM di Kota Tahu dengan Motto: "Membagun Kwalitas Kepribadian Entrepreneurship Pemuda Yang Mandiri dan Berkelanjutan" melalui program privat preneur, pondok preneur, cafepreneur, kajian bisnis, eo
    Bandung (Indonesia) - 14.102.153.21
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, SuperFish, Swf Object
    Number of Javascript: 4
    Number of meta tags: 6

Check Other Websites